| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145184.1 | internal | 199 | 3-599(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTLLKELVDMGFKQIDLNK | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 21,465.670 | ||
| Theoretical pI: | 4.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 39.803 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.302 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145184.1 | internal | 199 | 3-599(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAADGNQVEQTLLKELVDMGFKQIDLNK | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 21,465.670 | ||
| Theoretical pI: | 4.229 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 39.803 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.302 | ||
| sheet | 0.226 | ||