| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145189.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| FLHTLLNMKKLAGTQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTR LIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 14,433.840 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 33.768 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.208 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145189.1 | complete | 120 | 469-107(-) |
Amino Acid sequence : | |||
| MTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHCGWFFNELRKYPFYDCR * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,433.840 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 33.768 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.208 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145189.1 | internal | 184 | 2-553(+) |
Amino Acid sequence : | |||
| FLHTLLNMKKLAGTQLTNEHIKGMLMNIFIGGTYTSSAVVEWIFTELIKKPAAMKKAQDEVRSVVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTR LIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVELPL | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 14,433.840 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 33.768 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.208 | ||
| sheet | 0.183 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145189.1 | complete | 120 | 469-107(-) |
Amino Acid sequence : | |||
| MTLKINGTINESLRIEFIRIFPNICIPSHRKCIYNQPRFGWYVITIDPTVLHCFSFVKQWSYRMQSHRLLNNTLEIMKLVKVNLLDLPLASDNTSHFVLCFLHCGWFFNELRKYPFYDCR * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 14,433.840 | ||
| Theoretical pI: | 9.170 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24325 | ||
| Instability index: | 33.768 | ||
| aromaticity | 0.150 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.408 | ||
| turn | 0.208 | ||
| sheet | 0.183 | ||