Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145196.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
RRRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGPV RYR* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 11,988.554 | ||
Theoretical pI: | 8.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 26.197 | ||
aromaticity | 0.059 | ||
GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.288 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145196.1 | 5prime_partial | 118 | 605-249(-) |
Amino Acid sequence : | |||
SRAMITVTIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 11,988.554 | ||
Theoretical pI: | 8.957 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 26.197 | ||
aromaticity | 0.059 | ||
GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.288 | ||
sheet | 0.229 |