| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145196.1 | 5prime_partial | 123 | 2-373(+) |
Amino Acid sequence : | |||
| RRRWRREMAFMICFPMMIMMLFLFPLISFAQPISVHTYPAALKSSSVIPQPQDNQQVVGQCLYTVQIHTSCLSPQKTNDYIAIKFGDSFYHRVYKQIKAPRRDFQFRNWLLRHIQHSGPV RYR* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 11,988.554 | ||
| Theoretical pI: | 8.957 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 26.197 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.288 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145196.1 | 5prime_partial | 118 | 605-249(-) |
Amino Acid sequence : | |||
| SRAMITVTIIVSHIVVGGRGGDLSSAAVETAPYVIRKNAVKFEHGAAAVATVELPYRYGIGSPAVVPVSAQIQVANAISGTARALNVECVGGASCGTGNPFSAPLFAYTPGDKNCRQT* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 11,988.554 | ||
| Theoretical pI: | 8.957 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 26.197 | ||
| aromaticity | 0.059 | ||
| GRAVY | 0.304 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.288 | ||
| sheet | 0.229 | ||