| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145206.1 | 3prime_partial | 148 | 1-444(+) |
Amino Acid sequence : | |||
| MLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSMEV VNRLTTAVELPTEFVHMYITNCISSCEN | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,619.057 | ||
| Theoretical pI: | 4.490 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 38.160 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.209 | ||
| sheet | 0.372 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145206.1 | 3prime_partial | 148 | 1-444(+) |
Amino Acid sequence : | |||
| MLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSMEV VNRLTTAVELPTEFVHMYITNCISSCEN | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,619.057 | ||
| Theoretical pI: | 4.490 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 38.160 | ||
| aromaticity | 0.047 | ||
| GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.209 | ||
| sheet | 0.372 | ||