Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145206.1 | 3prime_partial | 148 | 1-444(+) |
Amino Acid sequence : | |||
MLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSMEV VNRLTTAVELPTEFVHMYITNCISSCEN | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,619.057 | ||
Theoretical pI: | 4.490 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 38.160 | ||
aromaticity | 0.047 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.209 | ||
sheet | 0.372 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145206.1 | 3prime_partial | 148 | 1-444(+) |
Amino Acid sequence : | |||
MLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSMEV VNRLTTAVELPTEFVHMYITNCISSCEN | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,619.057 | ||
Theoretical pI: | 4.490 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 38.160 | ||
aromaticity | 0.047 | ||
GRAVY | 0.066 | ||
Secondary Structure Fraction | |||
Helix | 0.324 | ||
turn | 0.209 | ||
sheet | 0.372 |