| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145207.1 | internal | 214 | 2-643(+) |
Amino Acid sequence : | |||
| ARGEPNGSRECDAHLEFSTSAAESSNSGAPNDEDVVSNRNRMEVVKSNMTNIKRTSVLGEKKENDLEETVGENEPCAVFSSKACNFVSRQETVTRPACGERAYIAVQNMLLHGLGPIIGA KDIFRISRTPLVNNIGEVRFELFQKQVEVIKNLRGNANVRYAWLASSKDAVEDLMQRGLLTCKVPERRPSNGIGMRLVPANCSNICARYSDIDE | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 23,619.374 | ||
| Theoretical pI: | 6.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 40.142 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.280 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145207.1 | internal | 214 | 2-643(+) |
Amino Acid sequence : | |||
| ARGEPNGSRECDAHLEFSTSAAESSNSGAPNDEDVVSNRNRMEVVKSNMTNIKRTSVLGEKKENDLEETVGENEPCAVFSSKACNFVSRQETVTRPACGERAYIAVQNMLLHGLGPIIGA KDIFRISRTPLVNNIGEVRFELFQKQVEVIKNLRGNANVRYAWLASSKDAVEDLMQRGLLTCKVPERRPSNGIGMRLVPANCSNICARYSDIDE | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 23,619.374 | ||
| Theoretical pI: | 6.269 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 40.142 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.486 | ||
Secondary Structure Fraction | |||
| Helix | 0.248 | ||
| turn | 0.280 | ||
| sheet | 0.262 | ||