| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145212.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| ERASSSKLLERLLSNPIHRTLAPSSSAVRSFNTNTAQMSSDGDSSSEGSSNIAHRRSDAPSRRRPGGLSRRRFRRGEDGDDEYYPAIFSGDVFDPRPSLSRVLNMMDRMMDLPVSVQRQR GWDAREEEDALHLRVDMPGLGKEHVRVSAEGSTLIIEGEREGEGEGEEDGERRRYRSRIELPDEVYRMDGIRAEM | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 11,979.048 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 45.858 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145212.1 | 5prime_partial | 112 | 587-249(-) |
Amino Acid sequence : | |||
| FISALIPSILYTSSGSSMRLLYLLLSPSSSPSPSPSRSPSMISVLPSALTLTCSFPSPGMSTRRCSASSSSRASHPLCLCTDTGRSIIRSIMFRTRLRLGRGSNTSPEKMAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,979.048 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 45.858 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145212.1 | 5prime_partial | 106 | 585-265(-) |
Amino Acid sequence : | |||
| HLCPDPIHPVHLIRQLNAASVPPPFTILLSLSLSLSLSLYDKRASLRTHPHVLLPQPRHVHAQMQRVLLLTCVPPPLPLHGHRKIHHPVHHVQNPAQARPRIKHVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,979.048 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 45.858 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145212.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
| ERASSSKLLERLLSNPIHRTLAPSSSAVRSFNTNTAQMSSDGDSSSEGSSNIAHRRSDAPSRRRPGGLSRRRFRRGEDGDDEYYPAIFSGDVFDPRPSLSRVLNMMDRMMDLPVSVQRQR GWDAREEEDALHLRVDMPGLGKEHVRVSAEGSTLIIEGEREGEGEGEEDGERRRYRSRIELPDEVYRMDGIRAEM | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 11,979.048 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 45.858 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145212.1 | 5prime_partial | 112 | 587-249(-) |
Amino Acid sequence : | |||
| FISALIPSILYTSSGSSMRLLYLLLSPSSSPSPSPSRSPSMISVLPSALTLTCSFPSPGMSTRRCSASSSSRASHPLCLCTDTGRSIIRSIMFRTRLRLGRGSNTSPEKMAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,979.048 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 45.858 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145212.1 | 5prime_partial | 106 | 585-265(-) |
Amino Acid sequence : | |||
| HLCPDPIHPVHLIRQLNAASVPPPFTILLSLSLSLSLSLYDKRASLRTHPHVLLPQPRHVHAQMQRVLLLTCVPPPLPLHGHRKIHHPVHHVQNPAQARPRIKHVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,979.048 | ||
| Theoretical pI: | 11.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 45.858 | ||
| aromaticity | 0.019 | ||
| GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.255 | ||
| sheet | 0.236 | ||