Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145212.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
ERASSSKLLERLLSNPIHRTLAPSSSAVRSFNTNTAQMSSDGDSSSEGSSNIAHRRSDAPSRRRPGGLSRRRFRRGEDGDDEYYPAIFSGDVFDPRPSLSRVLNMMDRMMDLPVSVQRQR GWDAREEEDALHLRVDMPGLGKEHVRVSAEGSTLIIEGEREGEGEGEEDGERRRYRSRIELPDEVYRMDGIRAEM | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 11,979.048 | ||
Theoretical pI: | 11.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 45.858 | ||
aromaticity | 0.019 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.255 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145212.1 | 5prime_partial | 112 | 587-249(-) |
Amino Acid sequence : | |||
FISALIPSILYTSSGSSMRLLYLLLSPSSSPSPSPSRSPSMISVLPSALTLTCSFPSPGMSTRRCSASSSSRASHPLCLCTDTGRSIIRSIMFRTRLRLGRGSNTSPEKMAG* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,979.048 | ||
Theoretical pI: | 11.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 45.858 | ||
aromaticity | 0.019 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.255 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145212.1 | 5prime_partial | 106 | 585-265(-) |
Amino Acid sequence : | |||
HLCPDPIHPVHLIRQLNAASVPPPFTILLSLSLSLSLSLYDKRASLRTHPHVLLPQPRHVHAQMQRVLLLTCVPPPLPLHGHRKIHHPVHHVQNPAQARPRIKHVS* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,979.048 | ||
Theoretical pI: | 11.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 45.858 | ||
aromaticity | 0.019 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.255 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145212.1 | internal | 195 | 1-585(+) |
Amino Acid sequence : | |||
ERASSSKLLERLLSNPIHRTLAPSSSAVRSFNTNTAQMSSDGDSSSEGSSNIAHRRSDAPSRRRPGGLSRRRFRRGEDGDDEYYPAIFSGDVFDPRPSLSRVLNMMDRMMDLPVSVQRQR GWDAREEEDALHLRVDMPGLGKEHVRVSAEGSTLIIEGEREGEGEGEEDGERRRYRSRIELPDEVYRMDGIRAEM | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 11,979.048 | ||
Theoretical pI: | 11.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 45.858 | ||
aromaticity | 0.019 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.255 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145212.1 | 5prime_partial | 112 | 587-249(-) |
Amino Acid sequence : | |||
FISALIPSILYTSSGSSMRLLYLLLSPSSSPSPSPSRSPSMISVLPSALTLTCSFPSPGMSTRRCSASSSSRASHPLCLCTDTGRSIIRSIMFRTRLRLGRGSNTSPEKMAG* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 11,979.048 | ||
Theoretical pI: | 11.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 45.858 | ||
aromaticity | 0.019 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.255 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145212.1 | 5prime_partial | 106 | 585-265(-) |
Amino Acid sequence : | |||
HLCPDPIHPVHLIRQLNAASVPPPFTILLSLSLSLSLSLYDKRASLRTHPHVLLPQPRHVHAQMQRVLLLTCVPPPLPLHGHRKIHHPVHHVQNPAQARPRIKHVS* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,979.048 | ||
Theoretical pI: | 11.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 45.858 | ||
aromaticity | 0.019 | ||
GRAVY | -0.133 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.255 | ||
sheet | 0.236 |