Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145214.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
VPRRYSFNLFLLFPEKMSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKE KDEEEEESRWHRVERSSGKFTRRFRLPENAKLDRVKATMENGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 19,792.255 | ||
Theoretical pI: | 5.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.206 | ||
aromaticity | 0.045 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.254 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145214.1 | 5prime_partial | 184 | 567-13(-) |
Amino Acid sequence : | |||
GSQAPEMSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEV SPGKLRLGVEVDRKSWRNGQRSKGSHRSRDKGSRMLLGREPNPNPNPLGTIDIFSGNKRKRLKL* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,792.255 | ||
Theoretical pI: | 5.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.206 | ||
aromaticity | 0.045 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.254 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145214.1 | 5prime_partial | 177 | 568-35(-) |
Amino Acid sequence : | |||
RLSGSRDVNGLDFRLLDLLFSHSDSEHSVLHRSLHPIQFRILRQPESSRKLSAAPLDPVPPGLLLLLVLLLSPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGG LAGEVETRSGSRQEVVEERTAIEGVPQVERQGVKDVAWSRTQPEPEPTGDYRHFFWK* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,792.255 | ||
Theoretical pI: | 5.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.206 | ||
aromaticity | 0.045 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.254 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145214.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
VPRRYSFNLFLLFPEKMSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKE KDEEEEESRWHRVERSSGKFTRRFRLPENAKLDRVKATMENGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
Number of amino acids: | 186 | ||
Molecular weight: | 19,792.255 | ||
Theoretical pI: | 5.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.206 | ||
aromaticity | 0.045 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.254 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145214.1 | 5prime_partial | 184 | 567-13(-) |
Amino Acid sequence : | |||
GSQAPEMSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEV SPGKLRLGVEVDRKSWRNGQRSKGSHRSRDKGSRMLLGREPNPNPNPLGTIDIFSGNKRKRLKL* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,792.255 | ||
Theoretical pI: | 5.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.206 | ||
aromaticity | 0.045 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.254 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145214.1 | 5prime_partial | 177 | 568-35(-) |
Amino Acid sequence : | |||
RLSGSRDVNGLDFRLLDLLFSHSDSEHSVLHRSLHPIQFRILRQPESSRKLSAAPLDPVPPGLLLLLVLLLSPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGG LAGEVETRSGSRQEVVEERTAIEGVPQVERQGVKDVAWSRTQPEPEPTGDYRHFFWK* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,792.255 | ||
Theoretical pI: | 5.686 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 54.206 | ||
aromaticity | 0.045 | ||
GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.254 | ||
sheet | 0.299 |