| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145214.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
| VPRRYSFNLFLLFPEKMSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKE KDEEEEESRWHRVERSSGKFTRRFRLPENAKLDRVKATMENGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 19,792.255 | ||
| Theoretical pI: | 5.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 54.206 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145214.1 | 5prime_partial | 184 | 567-13(-) |
Amino Acid sequence : | |||
| GSQAPEMSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEV SPGKLRLGVEVDRKSWRNGQRSKGSHRSRDKGSRMLLGREPNPNPNPLGTIDIFSGNKRKRLKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,792.255 | ||
| Theoretical pI: | 5.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 54.206 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145214.1 | 5prime_partial | 177 | 568-35(-) |
Amino Acid sequence : | |||
| RLSGSRDVNGLDFRLLDLLFSHSDSEHSVLHRSLHPIQFRILRQPESSRKLSAAPLDPVPPGLLLLLVLLLSPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGG LAGEVETRSGSRQEVVEERTAIEGVPQVERQGVKDVAWSRTQPEPEPTGDYRHFFWK* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,792.255 | ||
| Theoretical pI: | 5.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 54.206 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145214.1 | 5prime_partial | 186 | 2-562(+) |
Amino Acid sequence : | |||
| VPRRYSFNLFLLFPEKMSIVPSGFGFGLGSRPSNILDPLSLDLWDPFDRCPFLHDFLSTSTPSLNFPGETSALANTRVDWKETPRAHVFRVDLPGIKKEEVKVEVEEGRVLQISGERRKE KDEEEEESRWHRVERSSGKFTRRFRLPENAKLDRVKATMENGVLTVTVAKEEVKKPEVKAIDISGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 186 | ||
| Molecular weight: | 19,792.255 | ||
| Theoretical pI: | 5.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 54.206 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145214.1 | 5prime_partial | 184 | 567-13(-) |
Amino Acid sequence : | |||
| GSQAPEMSMALTSGFLTSSLATVTVSTPFSIVAFTRSSFAFSGSRNLRVNFPLLLSTRCHRDSSSSSSFSFLLSPLIWRTLPSSTSTFTSSFLIPGRSTLNTCALGVSFQSTRVLARAEV SPGKLRLGVEVDRKSWRNGQRSKGSHRSRDKGSRMLLGREPNPNPNPLGTIDIFSGNKRKRLKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 184 | ||
| Molecular weight: | 19,792.255 | ||
| Theoretical pI: | 5.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 54.206 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145214.1 | 5prime_partial | 177 | 568-35(-) |
Amino Acid sequence : | |||
| RLSGSRDVNGLDFRLLDLLFSHSDSEHSVLHRSLHPIQFRILRQPESSRKLSAAPLDPVPPGLLLLLVLLLSPLAADLEDSPLLHLDLHLLLLDPREVDPEHVRPGRLLPVHTCVGQSGG LAGEVETRSGSRQEVVEERTAIEGVPQVERQGVKDVAWSRTQPEPEPTGDYRHFFWK* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 19,792.255 | ||
| Theoretical pI: | 5.686 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
| Instability index: | 54.206 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.306 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.254 | ||
| sheet | 0.299 | ||