Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145222.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
GLQEFGQSLALVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRAS | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,544.871 | ||
Theoretical pI: | 7.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 74.189 | ||
aromaticity | 0.029 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.377 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145222.1 | internal | 138 | 416-3(-) |
Amino Acid sequence : | |||
IEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNT REPNPNGTSARLWPNSCS | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,544.871 | ||
Theoretical pI: | 7.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 74.189 | ||
aromaticity | 0.029 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.377 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145222.1 | internal | 138 | 414-1(-) |
Amino Acid sequence : | |||
RSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIEGRGGIEHS RTESEWNKRETLAEFLQP | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,544.871 | ||
Theoretical pI: | 7.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 74.189 | ||
aromaticity | 0.029 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.377 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145222.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
GLQEFGQSLALVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRAS | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,544.871 | ||
Theoretical pI: | 7.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 74.189 | ||
aromaticity | 0.029 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.377 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145222.1 | internal | 138 | 416-3(-) |
Amino Acid sequence : | |||
IEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNT REPNPNGTSARLWPNSCS | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,544.871 | ||
Theoretical pI: | 7.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 74.189 | ||
aromaticity | 0.029 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.377 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145222.1 | internal | 138 | 414-1(-) |
Amino Acid sequence : | |||
RSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIEGRGGIEHS RTESEWNKRETLAEFLQP | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,544.871 | ||
Theoretical pI: | 7.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 74.189 | ||
aromaticity | 0.029 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.225 | ||
sheet | 0.377 |