| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145222.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| GLQEFGQSLALVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRAS | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,544.871 | ||
| Theoretical pI: | 7.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 74.189 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.377 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145222.1 | internal | 138 | 416-3(-) |
Amino Acid sequence : | |||
| IEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNT REPNPNGTSARLWPNSCS | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,544.871 | ||
| Theoretical pI: | 7.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 74.189 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.377 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145222.1 | internal | 138 | 414-1(-) |
Amino Acid sequence : | |||
| RSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIEGRGGIEHS RTESEWNKRETLAEFLQP | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,544.871 | ||
| Theoretical pI: | 7.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 74.189 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.377 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145222.1 | internal | 138 | 1-414(+) |
Amino Acid sequence : | |||
| GLQEFGQSLALVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKF LRRFRMPENAKVEEVRAS | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,544.871 | ||
| Theoretical pI: | 7.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 74.189 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.377 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145222.1 | internal | 138 | 416-3(-) |
Amino Acid sequence : | |||
| IEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFARGTTSRKKLSMGSQRSKDEEGSNT REPNPNGTSARLWPNSCS | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,544.871 | ||
| Theoretical pI: | 7.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 74.189 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.377 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145222.1 | internal | 138 | 414-1(-) |
Amino Acid sequence : | |||
| RSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVRTGNHVAEEAIDGIPEIEGRGGIEHS RTESEWNKRETLAEFLQP | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,544.871 | ||
| Theoretical pI: | 7.353 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 74.189 | ||
| aromaticity | 0.029 | ||
| GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.377 | ||