Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145224.1 | 5prime_partial | 132 | 3-401(+) |
Amino Acid sequence : | |||
TSNQPQNLQIKQAMAYQQQRNSGGSAREDYCSYVNNMERKTSMTKGPHFPNLQGALKQTEVQEVQVTEAIQGKMYSTDGRFGRSNHLECAVAVKKTIGDVQTNQGKMSSSTGRFGRAKHA AKKLSTGDMEKN* | |||
Physicochemical properties | |||
Number of amino acids: | 132 | ||
Molecular weight: | 14,588.164 | ||
Theoretical pI: | 9.695 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 43.514 | ||
aromaticity | 0.053 | ||
GRAVY | -1.006 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.265 | ||
sheet | 0.212 |