| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145224.1 | 5prime_partial | 132 | 3-401(+) |
Amino Acid sequence : | |||
| TSNQPQNLQIKQAMAYQQQRNSGGSAREDYCSYVNNMERKTSMTKGPHFPNLQGALKQTEVQEVQVTEAIQGKMYSTDGRFGRSNHLECAVAVKKTIGDVQTNQGKMSSSTGRFGRAKHA AKKLSTGDMEKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,588.164 | ||
| Theoretical pI: | 9.695 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 43.514 | ||
| aromaticity | 0.053 | ||
| GRAVY | -1.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.167 | ||
| turn | 0.265 | ||
| sheet | 0.212 | ||