| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145226.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| TRFNEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVV AVEITGGPDVPFLPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFE | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,215.906 | ||
| Theoretical pI: | 6.569 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 37.563 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.433 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.244 | ||
| sheet | 0.249 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145226.1 | internal | 193 | 3-581(+) |
Amino Acid sequence : | |||
| TRFNEGFYFNDQETDPTMGKSYPTVSAEYLKAVEKCKRKLRGFIAEKNCAPLMLRIAWHSAGTFDCKSKTGGPFGTMRHKAELAHGANNGLDIAVRLLEPIKEQFPIISYADFYQLAGVV AVEITGGPDVPFLPGREDKPEPPVEGRLPDATKGCDHLRTVFGEQMGLSDKDIVALSGGHTLGRCHKDRSGFE | |||
Physicochemical properties | |||
| Number of amino acids: | 193 | ||
| Molecular weight: | 21,215.906 | ||
| Theoretical pI: | 6.569 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 37.563 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.433 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.244 | ||
| sheet | 0.249 | ||