| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145249.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
| FLVAGGVSAFALAKTSSKTISKLAHPNAPLGYGLCFLNLAFDGFTNATQDSITARYPKTSAWEIMLGMNLWGTIYNVVYMFGWSRATGLEAVRFCQEHPEAAWDILMYCLCGAVGQNFIF LTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSLN | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,050.546 | ||
| Theoretical pI: | 8.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 22.022 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.261 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145249.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
| FLVAGGVSAFALAKTSSKTISKLAHPNAPLGYGLCFLNLAFDGFTNATQDSITARYPKTSAWEIMLGMNLWGTIYNVVYMFGWSRATGLEAVRFCQEHPEAAWDILMYCLCGAVGQNFIF LTISRFGSLANTTITTTRKFVSIVVSSLLSGNPLSLN | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 17,050.546 | ||
| Theoretical pI: | 8.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29450 29700 | ||
| Instability index: | 22.022 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.412 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.261 | ||
| sheet | 0.268 | ||