| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145251.1 | internal | 144 | 2-433(+) |
Amino Acid sequence : | |||
| PGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHE EIEEKKKMYRLINEYELEGHIRWI | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,947.201 | ||
| Theoretical pI: | 5.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 55.540 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.515 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.201 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145251.1 | internal | 144 | 2-433(+) |
Amino Acid sequence : | |||
| PGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHE EIEEKKKMYRLINEYELEGHIRWI | |||
Physicochemical properties | |||
| Number of amino acids: | 144 | ||
| Molecular weight: | 16,947.201 | ||
| Theoretical pI: | 5.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 55.540 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.515 | ||
Secondary Structure Fraction | |||
| Helix | 0.354 | ||
| turn | 0.201 | ||
| sheet | 0.264 | ||