Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145260.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
LIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPQQPTNNADKSSDFVIKILQFLVPILILVLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,336.868 | ||
Theoretical pI: | 4.854 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 29.264 | ||
aromaticity | 0.089 | ||
GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.232 | ||
sheet | 0.214 |