| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145264.1 | internal | 176 | 530-3(-) |
Amino Acid sequence : | |||
| QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIA | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 18,536.780 | ||
| Theoretical pI: | 6.982 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.477 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.665 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.241 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145264.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
| KAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRR FRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,536.780 | ||
| Theoretical pI: | 6.982 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.477 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.665 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.241 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145264.1 | internal | 176 | 530-3(-) |
Amino Acid sequence : | |||
| QDDQRTVRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQS MRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIA | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 18,536.780 | ||
| Theoretical pI: | 6.982 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.477 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.665 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.241 | ||
| sheet | 0.235 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145264.1 | 5prime_partial | 162 | 1-489(+) |
Amino Acid sequence : | |||
| KAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFLRR FRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,536.780 | ||
| Theoretical pI: | 6.982 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 54.477 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.665 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.241 | ||
| sheet | 0.235 | ||