| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145272.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| LGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGP ATLFFGCRNRRMDFIYEDELNNFLEKRALSELVVAFSREGPTKEYVQHKMAEKASEIWNVI | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 11,894.433 | ||
| Theoretical pI: | 9.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
| Instability index: | 56.350 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.291 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145272.1 | complete | 103 | 99-410(+) |
Amino Acid sequence : | |||
| MCFGSWTNTHGKNSQRNLLNMDEECSSTGGKPKLQLGSCICEAIKFQTSFRSIYSYYYDWSWYRVSTLQGLLAGKVGIEGRRRRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,894.433 | ||
| Theoretical pI: | 9.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
| Instability index: | 56.350 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.291 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145272.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
| LGVFFAAISPRLQPRYYSISSSPRMAPTRVHVTCALVHGPTPTGRIHKGICSTWMKNAVPLEENQNCSWAPVFVRQSNFKLPSDPSTPIIMIGPGTGLAPFRGFLQERLALREEGAELGP ATLFFGCRNRRMDFIYEDELNNFLEKRALSELVVAFSREGPTKEYVQHKMAEKASEIWNVI | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 11,894.433 | ||
| Theoretical pI: | 9.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
| Instability index: | 56.350 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.291 | ||
| sheet | 0.214 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145272.1 | complete | 103 | 99-410(+) |
Amino Acid sequence : | |||
| MCFGSWTNTHGKNSQRNLLNMDEECSSTGGKPKLQLGSCICEAIKFQTSFRSIYSYYYDWSWYRVSTLQGLLAGKVGIEGRRRRAWPSHSLLWMQEPKNGLHL* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,894.433 | ||
| Theoretical pI: | 9.386 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 35200 | ||
| Instability index: | 56.350 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.575 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.291 | ||
| sheet | 0.214 | ||