| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145281.1 | internal | 169 | 3-509(+) |
Amino Acid sequence : | |||
| SIMGDDEPLDFEKEDLLLTPSRPSSKRRKVIGLDDLLKDYYNEQSKLVQSKSKKSMLSREYNSEDEDDHTRKLSEVVKDVVDDCQKQVREIHREDEIPLWGQTMFGNQKAPPATFLGQPN CGFIQSLAMDKLNSVLELDAGQGESFLEGLLINGWLLKLSLICGSVEES | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,120.347 | ||
| Theoretical pI: | 4.676 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 46.409 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.243 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145281.1 | internal | 169 | 3-509(+) |
Amino Acid sequence : | |||
| SIMGDDEPLDFEKEDLLLTPSRPSSKRRKVIGLDDLLKDYYNEQSKLVQSKSKKSMLSREYNSEDEDDHTRKLSEVVKDVVDDCQKQVREIHREDEIPLWGQTMFGNQKAPPATFLGQPN CGFIQSLAMDKLNSVLELDAGQGESFLEGLLINGWLLKLSLICGSVEES | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,120.347 | ||
| Theoretical pI: | 4.676 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 46.409 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.602 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.243 | ||
| sheet | 0.278 | ||