Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145287.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
LRSSHGDILRKQQFFLESPATSPVYRAQFGMASVSQSLMPGRRLVSSSVGHRRHLRPYLRASDTRSAPTSDAITPEMTPERPLENKNVRKSTFPIGFEELVLNVCDQTNIAEVKLKVGDF EMRLKRDIGTPEAPNSAAPAIESPTIAPPVPSEPMIGSSPATQSVMPQKSSSAPSNPFANAISSKSLKLAALEASGSKSFVVVKSPTVGT | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 22,528.417 | ||
Theoretical pI: | 9.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 77.154 | ||
aromaticity | 0.048 | ||
GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.333 | ||
sheet | 0.248 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145287.1 | internal | 210 | 2-631(+) |
Amino Acid sequence : | |||
LRSSHGDILRKQQFFLESPATSPVYRAQFGMASVSQSLMPGRRLVSSSVGHRRHLRPYLRASDTRSAPTSDAITPEMTPERPLENKNVRKSTFPIGFEELVLNVCDQTNIAEVKLKVGDF EMRLKRDIGTPEAPNSAAPAIESPTIAPPVPSEPMIGSSPATQSVMPQKSSSAPSNPFANAISSKSLKLAALEASGSKSFVVVKSPTVGT | |||
Physicochemical properties | |||
Number of amino acids: | 210 | ||
Molecular weight: | 22,528.417 | ||
Theoretical pI: | 9.803 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 77.154 | ||
aromaticity | 0.048 | ||
GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.233 | ||
turn | 0.333 | ||
sheet | 0.248 |