| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145289.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
| NDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK KMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQNQAPQRELWLSFWSEVHYNSLYDLRDV | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 22,010.834 | ||
| Theoretical pI: | 9.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 41.790 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.201 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145289.1 | internal | 189 | 2-568(+) |
Amino Acid sequence : | |||
| NDRMIAIALSEEYAKLDGAVARRVSNLSSVPHIPRINAFFPTLSDASLDHHRLIQRLNTYGLFEVKVSGDGNCQFRAISDQLYRSPDHHKHVRKEVVKQLKEFRSLYESYVPMKYKRYYK KMSKPGEWGDHVTLQAAADKFGAKICLLTSFRDTCFVEIVPQNQAPQRELWLSFWSEVHYNSLYDLRDV | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 22,010.834 | ||
| Theoretical pI: | 9.067 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31525 | ||
| Instability index: | 41.790 | ||
| aromaticity | 0.116 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.201 | ||
| sheet | 0.233 | ||