| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145300.1 | 3prime_partial | 183 | 38-586(+) |
Amino Acid sequence : | |||
| MGMVEKLAEEIKKGASSVEGVDVKLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAIT QLTHHGMIFVPIGYTFGAGMFEMEEVKGGSPYGSGTFAGDGSRTPTDLELKQAFHQGQYFANI | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 13,208.255 | ||
| Theoretical pI: | 7.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1990 | ||
| Instability index: | 73.576 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.389 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145300.1 | 3prime_partial | 131 | 393-1(-) |
Amino Acid sequence : | |||
| MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLTSTPSTDDAPFLISSASFSTMPIH GVIHYVDLGSC | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 13,208.255 | ||
| Theoretical pI: | 7.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1990 | ||
| Instability index: | 73.576 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.389 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145300.1 | 3prime_partial | 183 | 38-586(+) |
Amino Acid sequence : | |||
| MGMVEKLAEEIKKGASSVEGVDVKLWQVPETLHEDILGKMSAPPKSEVPIITPNELAEADGLIFGFPTRFGMMAAQFKAFLDATGGLWRAQQLAGKPAGIFFSTGSQGGGQETTALTAIT QLTHHGMIFVPIGYTFGAGMFEMEEVKGGSPYGSGTFAGDGSRTPTDLELKQAFHQGQYFANI | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 13,208.255 | ||
| Theoretical pI: | 7.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1990 | ||
| Instability index: | 73.576 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.389 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145300.1 | 3prime_partial | 131 | 393-1(-) |
Amino Acid sequence : | |||
| MAVNAVVSCPPPCDPVLKNIPAGFPASCCALQSPPVASRKALNCAAIMPNLVGNPKINPSASASSFGVMIGTSLLGGALIFPSMSSCRVSGTCHSLTSTPSTDDAPFLISSASFSTMPIH GVIHYVDLGSC | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 13,208.255 | ||
| Theoretical pI: | 7.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1990 | ||
| Instability index: | 73.576 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.504 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.389 | ||
| sheet | 0.221 | ||