| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145302.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
| DFAVGVMINDSEKKQTLIGGEWVPRKVIGSVPHDIGQNDPWFEVNAYNLHNTSRWKDLNPKFVLQVYRDVVATGDKAFARAVWPAVYMAMAYMDQFDKDKDGMIENEGFPDQTYDVWSVT GVSAYTGGLWVAA | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,981.679 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 32.820 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.218 | ||
| sheet | 0.203 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145302.1 | internal | 133 | 2-400(+) |
Amino Acid sequence : | |||
| DFAVGVMINDSEKKQTLIGGEWVPRKVIGSVPHDIGQNDPWFEVNAYNLHNTSRWKDLNPKFVLQVYRDVVATGDKAFARAVWPAVYMAMAYMDQFDKDKDGMIENEGFPDQTYDVWSVT GVSAYTGGLWVAA | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,981.679 | ||
| Theoretical pI: | 4.719 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41940 41940 | ||
| Instability index: | 32.820 | ||
| aromaticity | 0.135 | ||
| GRAVY | -0.296 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.218 | ||
| sheet | 0.203 | ||