| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145305.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| LALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMAHFSDVAEAYIEKRNQDRPYMP RYGLQRNLTDMSLARYAFDFYEMTSRTPIRAREAHIQMKAAALRGANNNLFGLDGNVGTTVENTERHT | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,668.303 | ||
| Theoretical pI: | 5.197 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 41.319 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.202 | ||
| sheet | 0.287 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145305.1 | internal | 188 | 1-564(+) |
Amino Acid sequence : | |||
| LALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMAHFSDVAEAYIEKRNQDRPYMP RYGLQRNLTDMSLARYAFDFYEMTSRTPIRAREAHIQMKAAALRGANNNLFGLDGNVGTTVENTERHT | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 21,668.303 | ||
| Theoretical pI: | 5.197 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 41.319 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.490 | ||
Secondary Structure Fraction | |||
| Helix | 0.277 | ||
| turn | 0.202 | ||
| sheet | 0.287 | ||