| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145309.1 | internal | 155 | 3-467(+) |
Amino Acid sequence : | |||
| VAKAVTKKAAIDWEGMARVIVSDESRKELATLRRAFDEVNQQLETKFSQEPETIDWEYYRKGIGSRLVDMYKDAYDKIEIPKFVDNVTPEYKPKFDALLVELKEAEQQSLKESERLEKEI AEAREMKEKISTMTADDYFAKHPELKKKFDDEMRN | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 18,232.456 | ||
| Theoretical pI: | 5.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 36.273 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.892 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.116 | ||
| sheet | 0.329 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145309.1 | internal | 155 | 3-467(+) |
Amino Acid sequence : | |||
| VAKAVTKKAAIDWEGMARVIVSDESRKELATLRRAFDEVNQQLETKFSQEPETIDWEYYRKGIGSRLVDMYKDAYDKIEIPKFVDNVTPEYKPKFDALLVELKEAEQQSLKESERLEKEI AEAREMKEKISTMTADDYFAKHPELKKKFDDEMRN | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 18,232.456 | ||
| Theoretical pI: | 5.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 19940 | ||
| Instability index: | 36.273 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.892 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.116 | ||
| sheet | 0.329 | ||