| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145311.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
| IKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVSVSPCSHIGGHKYAGNVI IFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKI | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,177.724 | ||
| Theoretical pI: | 5.382 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 51.089 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.247 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145311.1 | internal | 190 | 3-572(+) |
Amino Acid sequence : | |||
| IKRTRLTVCEGEDGTESSNGDVLIFPEMIRYRRLTHFDIDNFVEEVLVKETQWLPGAVETLTGSYVFVCAHGSRDRRCGACGPVLVTKFKEEINLRGLQGQVSVSPCSHIGGHKYAGNVI IFSPNPNGEVTGHWYGYVTPEDVPVLLEQHIGKGEIIGHLWRGQMGLSEEEQKEAQELRLQLSIGSEDKI | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,177.724 | ||
| Theoretical pI: | 5.382 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24200 | ||
| Instability index: | 51.089 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.247 | ||
| sheet | 0.226 | ||