| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145312.1 | internal | 103 | 311-3(-) |
Amino Acid sequence : | |||
| RQLILESTNNLVHNSTFLHENKGRHCFNSPISSNILQLIDIHLEENDIGELLCQLSKNWGNHAAWRAPSSSEVDHHQLLGYVGLFELLLPFLSSVASNHRSFR | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,633.095 | ||
| Theoretical pI: | 10.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.928 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.301 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145312.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
| AEGAVIACHTTEEWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVGALKDELP | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,633.095 | ||
| Theoretical pI: | 10.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.928 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.301 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145312.1 | internal | 103 | 310-2(-) |
Amino Acid sequence : | |||
| GSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSSCCFHSSVVWQAITAPSA | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,633.095 | ||
| Theoretical pI: | 10.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.928 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.301 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145312.1 | internal | 103 | 311-3(-) |
Amino Acid sequence : | |||
| RQLILESTNNLVHNSTFLHENKGRHCFNSPISSNILQLIDIHLEENDIGELLCQLSKNWGNHAAWRAPSSSEVDHHQLLGYVGLFELLLPFLSSVASNHRSFR | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,633.095 | ||
| Theoretical pI: | 10.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.928 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.301 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145312.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
| AEGAVIACHTTEEWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVGALKDELP | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,633.095 | ||
| Theoretical pI: | 10.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.928 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.301 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145312.1 | internal | 103 | 310-2(-) |
Amino Acid sequence : | |||
| GSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSSCCFHSSVVWQAITAPSA | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,633.095 | ||
| Theoretical pI: | 10.221 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.928 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.301 | ||
| sheet | 0.204 | ||