Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145312.1 | internal | 103 | 311-3(-) |
Amino Acid sequence : | |||
RQLILESTNNLVHNSTFLHENKGRHCFNSPISSNILQLIDIHLEENDIGELLCQLSKNWGNHAAWRAPSSSEVDHHQLLGYVGLFELLLPFLSSVASNHRSFR | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,633.095 | ||
Theoretical pI: | 10.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.928 | ||
aromaticity | 0.068 | ||
GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145312.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
AEGAVIACHTTEEWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVGALKDELP | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,633.095 | ||
Theoretical pI: | 10.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.928 | ||
aromaticity | 0.068 | ||
GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145312.1 | internal | 103 | 310-2(-) |
Amino Acid sequence : | |||
GSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSSCCFHSSVVWQAITAPSA | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,633.095 | ||
Theoretical pI: | 10.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.928 | ||
aromaticity | 0.068 | ||
GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145312.1 | internal | 103 | 311-3(-) |
Amino Acid sequence : | |||
RQLILESTNNLVHNSTFLHENKGRHCFNSPISSNILQLIDIHLEENDIGELLCQLSKNWGNHAAWRAPSSSEVDHHQLLGYVGLFELLLPFLSSVASNHRSFR | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,633.095 | ||
Theoretical pI: | 10.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.928 | ||
aromaticity | 0.068 | ||
GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145312.1 | internal | 103 | 3-311(+) |
Amino Acid sequence : | |||
AEGAVIACHTTEEWKQQLEQANISKKLVVVDFTATWCPPCRMIAPIFAELAKKFTDVIFLKVDVDELKDVAADWAVEAMPTFIFVKEGTIVDKIVGALKDELP | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,633.095 | ||
Theoretical pI: | 10.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.928 | ||
aromaticity | 0.068 | ||
GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145312.1 | internal | 103 | 310-2(-) |
Amino Acid sequence : | |||
GSSSLRAPTILSTIVPSFTKIKVGIASTAQSAATSFNSSTSTLRKMTSVNFFASSAKIGAIMRHGGHQVAVKSTTTSFLDMLACSSCCFHSSVVWQAITAPSA | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,633.095 | ||
Theoretical pI: | 10.221 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.928 | ||
aromaticity | 0.068 | ||
GRAVY | 0.357 | ||
Secondary Structure Fraction | |||
Helix | 0.252 | ||
turn | 0.301 | ||
sheet | 0.204 |