Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145313.1 | 5prime_partial | 158 | 3-479(+) |
Amino Acid sequence : | |||
ENRSFSIIGYIWIKSHTAAKGFEDAKSVITALKSRGVSAVGAAGYCWGAKVVAELAKSGDIQSAVMLHPSFVTVDDIKEVKCPIAILGAEHDHLSPPALVKQFEGILAAKSGVESFVKIF PGVAHGWSVRYKEDDEVAVKSAEEAFQDMLGWFVKCLK* | |||
Physicochemical properties | |||
Number of amino acids: | 158 | ||
Molecular weight: | 17,037.441 | ||
Theoretical pI: | 6.589 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 26.346 | ||
aromaticity | 0.095 | ||
GRAVY | 0.141 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.209 | ||
sheet | 0.266 |