| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145336.1 | internal | 102 | 3-308(+) |
Amino Acid sequence : | |||
| KFRWIKLEDPVDTEQLRYPQALTKFCYFLMDALKERGARMKPLICACLAKEPDRVLIVGICGRPQFGALQGNSFGIAFKTAAEEIEAQHFHEFFESSWIVLS | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,712.519 | ||
| Theoretical pI: | 6.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.161 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.157 | ||
| sheet | 0.304 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145336.1 | internal | 102 | 3-308(+) |
Amino Acid sequence : | |||
| KFRWIKLEDPVDTEQLRYPQALTKFCYFLMDALKERGARMKPLICACLAKEPDRVLIVGICGRPQFGALQGNSFGIAFKTAAEEIEAQHFHEFFESSWIVLS | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,712.519 | ||
| Theoretical pI: | 6.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 37.161 | ||
| aromaticity | 0.127 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.157 | ||
| sheet | 0.304 | ||