Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145341.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
APMLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSM EVVNRLTTAVELPTEFVHMYITNCISSCENIKDKYMQNRLVR | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,333.101 | ||
Theoretical pI: | 4.766 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 40.361 | ||
aromaticity | 0.049 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.204 | ||
sheet | 0.358 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145341.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
APMLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSM EVVNRLTTAVELPTEFVHMYITNCISSCENIKDKYMQNRLVR | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,333.101 | ||
Theoretical pI: | 4.766 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
Instability index: | 40.361 | ||
aromaticity | 0.049 | ||
GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.204 | ||
sheet | 0.358 |