| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145341.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
| APMLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSM EVVNRLTTAVELPTEFVHMYITNCISSCENIKDKYMQNRLVR | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,333.101 | ||
| Theoretical pI: | 4.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 40.361 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.204 | ||
| sheet | 0.358 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145341.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
| APMLPILDGELMWLNPDNNHELLWDHGMCADTSRGAAVRDLIARALEGPLDPAQQEQVLVELASDPKLVYHCGITPRKLPELVENNPLIAVEILIKLMNSAEIEEYFTALVNMTMSLRSM EVVNRLTTAVELPTEFVHMYITNCISSCENIKDKYMQNRLVR | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,333.101 | ||
| Theoretical pI: | 4.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17210 | ||
| Instability index: | 40.361 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.204 | ||
| sheet | 0.358 | ||