Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145357.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
NREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRAGLVGTATC LARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNR | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 11,960.575 | ||
Theoretical pI: | 8.693 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 15.866 | ||
aromaticity | 0.053 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.298 | ||
sheet | 0.263 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145357.1 | 5prime_partial | 114 | 471-127(-) |
Amino Acid sequence : | |||
PVQGPPCRDRVLLCHGRVPLVQNLGGRLGLGIGSTRKTGGSADKAGALGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSALDGLDARL* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 11,960.575 | ||
Theoretical pI: | 8.693 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 15.866 | ||
aromaticity | 0.053 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.298 | ||
sheet | 0.263 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145357.1 | internal | 157 | 1-471(+) |
Amino Acid sequence : | |||
NREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRAGLVGTATC LARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNR | |||
Physicochemical properties | |||
Number of amino acids: | 157 | ||
Molecular weight: | 11,960.575 | ||
Theoretical pI: | 8.693 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 15.866 | ||
aromaticity | 0.053 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.298 | ||
sheet | 0.263 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145357.1 | 5prime_partial | 114 | 471-127(-) |
Amino Acid sequence : | |||
PVQGPPCRDRVLLCHGRVPLVQNLGGRLGLGIGSTRKTGGSADKAGALGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSALDGLDARL* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 11,960.575 | ||
Theoretical pI: | 8.693 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 15.866 | ||
aromaticity | 0.053 | ||
GRAVY | -0.082 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.298 | ||
sheet | 0.263 |