| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145379.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| HEPWSEYRYYDPRTVGLDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAIN VVCSSPEAATRVKSQLKRLARPMYSNPPIHGA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,766.696 | ||
| Theoretical pI: | 5.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 32.041 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.257 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145379.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| HEPWSEYRYYDPRTVGLDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAIN VVCSSPEAATRVKSQLKRLARPMYSNPPIHGA | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,766.696 | ||
| Theoretical pI: | 5.453 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 32.041 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.274 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.257 | ||
| sheet | 0.250 | ||