| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145389.1 | internal | 141 | 425-3(-) |
Amino Acid sequence : | |||
| VVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVDR EVRVLVEAEERVDVDHEGRLV | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,891.802 | ||
| Theoretical pI: | 4.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 31.838 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.277 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145389.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
| NKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLID ENMKSVMPGTFERHWGIFTYD | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,891.802 | ||
| Theoretical pI: | 4.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 31.838 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.277 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145389.1 | internal | 141 | 425-3(-) |
Amino Acid sequence : | |||
| VVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVDR EVRVLVEAEERVDVDHEGRLV | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,891.802 | ||
| Theoretical pI: | 4.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 31.838 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.277 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145389.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
| NKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLID ENMKSVMPGTFERHWGIFTYD | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,891.802 | ||
| Theoretical pI: | 4.965 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 31.838 | ||
| aromaticity | 0.149 | ||
| GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
| Helix | 0.348 | ||
| turn | 0.277 | ||
| sheet | 0.206 | ||