Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145389.1 | internal | 141 | 425-3(-) |
Amino Acid sequence : | |||
VVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVDR EVRVLVEAEERVDVDHEGRLV | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,891.802 | ||
Theoretical pI: | 4.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 31.838 | ||
aromaticity | 0.149 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.277 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145389.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
NKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLID ENMKSVMPGTFERHWGIFTYD | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,891.802 | ||
Theoretical pI: | 4.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 31.838 | ||
aromaticity | 0.149 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.277 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145389.1 | internal | 141 | 425-3(-) |
Amino Acid sequence : | |||
VVSENTPVTFESSRHDALHVLVDQSEEVHFDASRSQWCAFVISQLLQEPGVKLLGIIKIGILVSVRRPSRFPDYDLHVVDAGLLQGGDERVVVRIEHVAIPNVLILHRPTDPIEEGEVDR EVRVLVEAEERVDVDHEGRLV | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,891.802 | ||
Theoretical pI: | 4.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 31.838 | ||
aromaticity | 0.149 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.277 | ||
sheet | 0.206 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145389.1 | internal | 141 | 3-425(+) |
Amino Acid sequence : | |||
NKAPFVVNIYPFLSLYQNPDFPVDFAFFDGVGRPVKDENVRYSNMFDANYDTLVSALKKAGVDDMKIIVGEAGWPTDGNKNANLDYAEKFYSGLLKKLGNDKGTPLRPGSIEVYLFGLID ENMKSVMPGTFERHWGIFTYD | |||
Physicochemical properties | |||
Number of amino acids: | 141 | ||
Molecular weight: | 15,891.802 | ||
Theoretical pI: | 4.965 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 31.838 | ||
aromaticity | 0.149 | ||
GRAVY | -0.318 | ||
Secondary Structure Fraction | |||
Helix | 0.348 | ||
turn | 0.277 | ||
sheet | 0.206 |