| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145398.1 | complete | 112 | 114-452(+) |
Amino Acid sequence : | |||
| MSDLDVQIPTAFDPFAEANAEDSGAGTKEYVHVRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKEFCCNGTVVQDSELGQVIQLQGDQRKNVSAFLVQAGIVKKEHIKIHGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,494.052 | ||
| Theoretical pI: | 7.782 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 26.036 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.442 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.196 | ||
| sheet | 0.205 | ||