| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145399.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| HEANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSS GKFLRRFRMPENAKVEEVRASMENGVLTVTVP | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,094.310 | ||
| Theoretical pI: | 10.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.331 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145399.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
| RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGI PEIEGRGGIEHSRTESEWNERHLDCFALICLV | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,094.310 | ||
| Theoretical pI: | 10.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.331 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145399.1 | 5prime_partial | 148 | 459-13(-) |
Amino Acid sequence : | |||
| FGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,094.310 | ||
| Theoretical pI: | 10.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.331 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145399.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
| HEANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSS GKFLRRFRMPENAKVEEVRASMENGVLTVTVP | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,094.310 | ||
| Theoretical pI: | 10.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.331 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145399.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
| RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGI PEIEGRGGIEHSRTESEWNERHLDCFALICLV | |||
Physicochemical properties | |||
| Number of amino acids: | 152 | ||
| Molecular weight: | 16,094.310 | ||
| Theoretical pI: | 10.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.331 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145399.1 | 5prime_partial | 148 | 459-13(-) |
Amino Acid sequence : | |||
| FGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 16,094.310 | ||
| Theoretical pI: | 10.827 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.684 | ||
| aromaticity | 0.095 | ||
| GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.331 | ||
| sheet | 0.230 | ||