Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145399.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
HEANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSS GKFLRRFRMPENAKVEEVRASMENGVLTVTVP | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,094.310 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.684 | ||
aromaticity | 0.095 | ||
GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.331 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145399.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGI PEIEGRGGIEHSRTESEWNERHLDCFALICLV | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,094.310 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.684 | ||
aromaticity | 0.095 | ||
GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.331 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145399.1 | 5prime_partial | 148 | 459-13(-) |
Amino Acid sequence : | |||
FGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,094.310 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.684 | ||
aromaticity | 0.095 | ||
GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.331 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145399.1 | internal | 152 | 2-457(+) |
Amino Acid sequence : | |||
HEANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSS GKFLRRFRMPENAKVEEVRASMENGVLTVTVP | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,094.310 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.684 | ||
aromaticity | 0.095 | ||
GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.331 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145399.1 | internal | 152 | 457-2(-) |
Amino Acid sequence : | |||
RHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGI PEIEGRGGIEHSRTESEWNERHLDCFALICLV | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,094.310 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.684 | ||
aromaticity | 0.095 | ||
GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.331 | ||
sheet | 0.230 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145399.1 | 5prime_partial | 148 | 459-13(-) |
Amino Acid sequence : | |||
FGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMG SQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,094.310 | ||
Theoretical pI: | 10.827 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 42.684 | ||
aromaticity | 0.095 | ||
GRAVY | 0.111 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.331 | ||
sheet | 0.230 |