| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145411.1 | internal | 179 | 2-538(+) |
Amino Acid sequence : | |||
| PKLERKLKMLRIAGKRVLGLAGYGHRAVISPALSTVMVRGYHERVVDHYDNPRNVGSFDKKDPTVGTGLVGAPACGDVMKLQIKVDDETGKIVDACFKTFGCGSAIASSSVATEWVKGKQ MEEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEKKKAMKEGTTDAAAAHTD | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,277.179 | ||
| Theoretical pI: | 9.115 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 25.628 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.196 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145411.1 | internal | 179 | 2-538(+) |
Amino Acid sequence : | |||
| PKLERKLKMLRIAGKRVLGLAGYGHRAVISPALSTVMVRGYHERVVDHYDNPRNVGSFDKKDPTVGTGLVGAPACGDVMKLQIKVDDETGKIVDACFKTFGCGSAIASSSVATEWVKGKQ MEEVLSIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEKKKAMKEGTTDAAAAHTD | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 19,277.179 | ||
| Theoretical pI: | 9.115 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
| Instability index: | 25.628 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.196 | ||
| sheet | 0.274 | ||