| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145412.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
| SDARSDQINREEEEQGKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRA GLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSA | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 11,216.675 | ||
| Theoretical pI: | 7.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 11.751 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.296 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145412.1 | 5prime_partial | 108 | 479-153(-) |
Amino Acid sequence : | |||
| CRDRVLLCHGRVPLVQNLGGRLGLGIGSTGKTGGSADKAGTLGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSALDGLDAGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,216.675 | ||
| Theoretical pI: | 7.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 11.751 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.296 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145412.1 | internal | 159 | 3-479(+) |
Amino Acid sequence : | |||
| SDARSDQINREEEEQGKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRA GLVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSA | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 11,216.675 | ||
| Theoretical pI: | 7.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 11.751 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.296 | ||
| sheet | 0.269 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145412.1 | 5prime_partial | 108 | 479-153(-) |
Amino Acid sequence : | |||
| CRDRVLLCHGRVPLVQNLGGRLGLGIGSTGKTGGSADKAGTLGFAGEGPGLVGCILQWKRHVTLNFSDGLPNLTIYEGEKLKGNAVELFVYRAHDGLDSALDGLDAGL* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 11,216.675 | ||
| Theoretical pI: | 7.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 11.751 | ||
| aromaticity | 0.056 | ||
| GRAVY | 0.007 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.296 | ||
| sheet | 0.269 | ||