| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145420.1 | internal | 125 | 3-377(+) |
Amino Acid sequence : | |||
| ELVSLQSGTVKKDGEVVDAGKEREKKSKEVDVPEDKGKEVASKDRDVGSSSRGKVVPRLQKITKKMNLPMIKGNVILNMDHLIEYRPNQTDLFNTRATRSQFESWFEAVRKEYELDDTQM GIIMN | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,256.066 | ||
| Theoretical pI: | 8.183 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 26.425 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.838 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.216 | ||
| sheet | 0.232 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145420.1 | internal | 125 | 3-377(+) |
Amino Acid sequence : | |||
| ELVSLQSGTVKKDGEVVDAGKEREKKSKEVDVPEDKGKEVASKDRDVGSSSRGKVVPRLQKITKKMNLPMIKGNVILNMDHLIEYRPNQTDLFNTRATRSQFESWFEAVRKEYELDDTQM GIIMN | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,256.066 | ||
| Theoretical pI: | 8.183 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 26.425 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.838 | ||
Secondary Structure Fraction | |||
| Helix | 0.256 | ||
| turn | 0.216 | ||
| sheet | 0.232 | ||