| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145424.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
| TSIGAATSPTRHPCSAHQVMYELRDYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVG GGLVYG | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,701.512 | ||
| Theoretical pI: | 5.796 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 43.382 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.222 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145424.1 | internal | 126 | 3-380(+) |
Amino Acid sequence : | |||
| TSIGAATSPTRHPCSAHQVMYELRDYSLEEATFGSVLASRAIRAAHCLTSIQFSPTSEHILLAYGRRHGTLLRSIVVDGEITVPIYTILEVYRVSDMELVKVIPSAEDEVNVACFHPLVG GGLVYG | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,701.512 | ||
| Theoretical pI: | 5.796 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 43.382 | ||
| aromaticity | 0.071 | ||
| GRAVY | 0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.341 | ||
| turn | 0.222 | ||
| sheet | 0.270 | ||