| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145434.1 | internal | 169 | 507-1(-) |
Amino Acid sequence : | |||
| NTDPRTQISHITTTETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILELFPGKD EPLLVRRNPFLVLNLCLHIVNRVGALDLEGNGLPSQGLDEDLHATTETE | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 17,930.401 | ||
| Theoretical pI: | 8.122 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 30.909 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.175 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145434.1 | 5prime_partial | 160 | 1-483(+) |
Amino Acid sequence : | |||
| LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,930.401 | ||
| Theoretical pI: | 8.122 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 30.909 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.175 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145434.1 | internal | 169 | 507-1(-) |
Amino Acid sequence : | |||
| NTDPRTQISHITTTETENKMEGGLLLDVVIRKGPPILQLLPSKNQPLLVRRNPLLILNLRLHIINRIRALHLQSNSLPGQGLHEYLHATTKPQNEMEGRLLLDVVVRKGPPILELFPGKD EPLLVRRNPFLVLNLCLHIVNRVGALDLEGNGLPSQGLDEDLHATTETE | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 17,930.401 | ||
| Theoretical pI: | 8.122 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 30.909 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.175 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145434.1 | 5prime_partial | 160 | 1-483(+) |
Amino Acid sequence : | |||
| LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGDM* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 17,930.401 | ||
| Theoretical pI: | 8.122 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 30.909 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.446 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.175 | ||
| sheet | 0.244 | ||