| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145438.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
| EELLRIYGNSKGLMESAEITTSQIPRSPILTTDISSTVAEAKQVAACTYESNTYWGKEIGWIYGSMTEDILTGLRIHSKGWKSAYLNLEPPAFLGNAPTGGPASLTQYKRWTTGLLEVL | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,056.649 | ||
| Theoretical pI: | 5.362 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
| Instability index: | 53.168 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.269 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145438.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
| EELLRIYGNSKGLMESAEITTSQIPRSPILTTDISSTVAEAKQVAACTYESNTYWGKEIGWIYGSMTEDILTGLRIHSKGWKSAYLNLEPPAFLGNAPTGGPASLTQYKRWTTGLLEVL | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 13,056.649 | ||
| Theoretical pI: | 5.362 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
| Instability index: | 53.168 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.269 | ||
| sheet | 0.286 | ||