Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145438.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
EELLRIYGNSKGLMESAEITTSQIPRSPILTTDISSTVAEAKQVAACTYESNTYWGKEIGWIYGSMTEDILTGLRIHSKGWKSAYLNLEPPAFLGNAPTGGPASLTQYKRWTTGLLEVL | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,056.649 | ||
Theoretical pI: | 5.362 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 53.168 | ||
aromaticity | 0.092 | ||
GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.269 | ||
sheet | 0.286 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145438.1 | internal | 119 | 3-359(+) |
Amino Acid sequence : | |||
EELLRIYGNSKGLMESAEITTSQIPRSPILTTDISSTVAEAKQVAACTYESNTYWGKEIGWIYGSMTEDILTGLRIHSKGWKSAYLNLEPPAFLGNAPTGGPASLTQYKRWTTGLLEVL | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,056.649 | ||
Theoretical pI: | 5.362 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 53.168 | ||
aromaticity | 0.092 | ||
GRAVY | -0.224 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.269 | ||
sheet | 0.286 |