| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145440.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
| CSLTQQAFRSHYSRSYSALPSFGLLAGRRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPPRTPKVSTKFSDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANGGIPWFVL TAAVFSAASLIPLLKGVTVQSKSDGVMTADARVVERKVCHAW | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 10,819.963 | ||
| Theoretical pI: | 6.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 39.105 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.333 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145440.1 | 5prime_partial | 108 | 485-159(-) |
Amino Acid sequence : | |||
| QAWQTFRSTTLASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNASTSENFVLTLGVLGGGGAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 10,819.963 | ||
| Theoretical pI: | 6.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 39.105 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.333 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145440.1 | internal | 162 | 1-486(+) |
Amino Acid sequence : | |||
| CSLTQQAFRSHYSRSYSALPSFGLLAGRRTSGMAIRCQVEDQEPGKTTPVTPPQVAPPPPRTPKVSTKFSDVLAFSGPAPERINGRLAMVGFVAAVAVELARGDDLAVQLANGGIPWFVL TAAVFSAASLIPLLKGVTVQSKSDGVMTADARVVERKVCHAW | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 10,819.963 | ||
| Theoretical pI: | 6.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 39.105 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.333 | ||
| sheet | 0.278 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145440.1 | 5prime_partial | 108 | 485-159(-) |
Amino Acid sequence : | |||
| QAWQTFRSTTLASAVITPSDLDCTVTPFKSGINEAAENTAAVKTNHGIPPFASCTARSSPLANSTATAATNPTMANRPLILSGAGPLNASTSENFVLTLGVLGGGGAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 10,819.963 | ||
| Theoretical pI: | 6.752 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 39.105 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.070 | ||
Secondary Structure Fraction | |||
| Helix | 0.213 | ||
| turn | 0.333 | ||
| sheet | 0.278 | ||