| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145443.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,722.531 | ||
| Theoretical pI: | 4.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 43.635 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.320 | ||
| sheet | 0.217 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145443.1 | internal | 175 | 3-527(+) |
Amino Acid sequence : | |||
| GDQFGDHSSADLEIPENGFPVEGELDIAVDFMAPSRPGRYVSYWRMASPSGQKFGQRVWVLIQVDYSRPNTPGTVTHPELNLNLPPGSNGRTGVAIIDVNVAPPDSGFTESDITCTAEEL VKSVEEHPSQVVVGDLLDASNDALPHPQPTLADVVPPTTLYPLIDIPSPEVPAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 175 | ||
| Molecular weight: | 18,722.531 | ||
| Theoretical pI: | 4.192 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 43.635 | ||
| aromaticity | 0.063 | ||
| GRAVY | -0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.320 | ||
| sheet | 0.217 | ||