| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145448.1 | internal | 150 | 450-1(-) |
Amino Acid sequence : | |||
| YIKDQHSFNGSVNFLHLALLSSFLKRGHFNVISSSFILIDAQTQLQHSVDPTSKGIRIVQAEPRSKQSGLIEQQHQILHRLIIPIRLRPLPQLLHDPILRIDLHRLLARHVRAHAAVPQS LRLHDPLHVRSPSVLSRHQAARGIHDPIRD | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,567.404 | ||
| Theoretical pI: | 4.434 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.209 | ||
| sheet | 0.367 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145448.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| VSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADRNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLGIDEDEAAADD IEMPPLEETAEESKMEEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,567.404 | ||
| Theoretical pI: | 4.434 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.209 | ||
| sheet | 0.367 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145448.1 | internal | 150 | 450-1(-) |
Amino Acid sequence : | |||
| YIKDQHSFNGSVNFLHLALLSSFLKRGHFNVISSSFILIDAQTQLQHSVDPTSKGIRIVQAEPRSKQSGLIEQQHQILHRLIIPIRLRPLPQLLHDPILRIDLHRLLARHVRAHAAVPQS LRLHDPLHVRSPSVLSRHQAARGIHDPIRD | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 15,567.404 | ||
| Theoretical pI: | 4.434 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.209 | ||
| sheet | 0.367 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145448.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
| VSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADRNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGLGIDEDEAAADD IEMPPLEETAEESKMEEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,567.404 | ||
| Theoretical pI: | 4.434 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 49.614 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.237 | ||
| turn | 0.209 | ||
| sheet | 0.367 | ||