Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX145454.1 | 5prime_partial | 139 | 1-420(+) |
Amino Acid sequence : | |||
SPTSKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPPLQPTNNADKSSDFVIKILQFLV PILILGLAFGVRHFTKVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 15,358.209 | ||
Theoretical pI: | 5.269 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 33.209 | ||
aromaticity | 0.094 | ||
GRAVY | -0.247 | ||
Secondary Structure Fraction | |||
Helix | 0.302 | ||
turn | 0.237 | ||
sheet | 0.216 |