| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145459.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| SNHVNVTAASDLDALAPGKTAGHSEGDSPEDIAQEDKPRSRIFAEYLAHGYVLTDNAIEKAIALDQQHGVSSRFTTTLQQFDAKYRATEKAQAIDQQYGLSQKANQGWRGLSSYFEKAAE TPTGQKMRAFYEQGSKQVLDVHNEAKHLA | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 13,757.996 | ||
| Theoretical pI: | 4.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 21.961 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.259 | ||
| sheet | 0.353 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145459.1 | 5prime_partial | 139 | 448-29(-) |
Amino Acid sequence : | |||
| SKVLGLVVHIKDLLGALLVEGTHLLAGRGLGGLLEVGRQTSPSLVGLLGETVLLVDGLGLLGRSVLGVELLQGGGKAAGDAVLLVKRDGLLDGVVGEDVAVGEVLGKDAAPGLVLLCDIF GRVTLGVTGGLARGEGVEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 13,757.996 | ||
| Theoretical pI: | 4.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 21.961 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.259 | ||
| sheet | 0.353 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145459.1 | internal | 149 | 2-448(+) |
Amino Acid sequence : | |||
| SNHVNVTAASDLDALAPGKTAGHSEGDSPEDIAQEDKPRSRIFAEYLAHGYVLTDNAIEKAIALDQQHGVSSRFTTTLQQFDAKYRATEKAQAIDQQYGLSQKANQGWRGLSSYFEKAAE TPTGQKMRAFYEQGSKQVLDVHNEAKHLA | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 13,757.996 | ||
| Theoretical pI: | 4.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 21.961 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.259 | ||
| sheet | 0.353 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145459.1 | 5prime_partial | 139 | 448-29(-) |
Amino Acid sequence : | |||
| SKVLGLVVHIKDLLGALLVEGTHLLAGRGLGGLLEVGRQTSPSLVGLLGETVLLVDGLGLLGRSVLGVELLQGGGKAAGDAVLLVKRDGLLDGVVGEDVAVGEVLGKDAAPGLVLLCDIF GRVTLGVTGGLARGEGVEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 13,757.996 | ||
| Theoretical pI: | 4.894 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 21.961 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.768 | ||
Secondary Structure Fraction | |||
| Helix | 0.410 | ||
| turn | 0.259 | ||
| sheet | 0.353 | ||