| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145477.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| HEVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVEL PLANLLYS | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,633.768 | ||
| Theoretical pI: | 5.941 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 34.212 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.227 | ||
| sheet | 0.266 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145477.1 | internal | 128 | 2-385(+) |
Amino Acid sequence : | |||
| HEVGSKGKVEEIDLDQLHYLKCIVKEAMRLHPIAPLLDERETMQHCRVNGYDIPPKTRLIINAFAMGRDANIWKNPDEFYPERFIDSSIDFKGHNFELIPFGAGRRICPGMNIGTLVVEL PLANLLYS | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,633.768 | ||
| Theoretical pI: | 5.941 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 34.212 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.235 | ||
Secondary Structure Fraction | |||
| Helix | 0.328 | ||
| turn | 0.227 | ||
| sheet | 0.266 | ||