| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145483.1 | internal | 209 | 2-628(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQILQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLAS | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 24,134.283 | ||
| Theoretical pI: | 6.326 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 49.313 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.674 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.163 | ||
| sheet | 0.325 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145483.1 | internal | 209 | 2-628(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQILQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLAS | |||
Physicochemical properties | |||
| Number of amino acids: | 209 | ||
| Molecular weight: | 24,134.283 | ||
| Theoretical pI: | 6.326 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 49.313 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.674 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.163 | ||
| sheet | 0.325 | ||