| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145484.1 | internal | 104 | 3-314(+) |
Amino Acid sequence : | |||
| PGCRNSARASKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPP | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,391.575 | ||
| Theoretical pI: | 5.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 23.588 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.260 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145484.1 | internal | 104 | 3-314(+) |
Amino Acid sequence : | |||
| PGCRNSARASKMAGEKVYHFDEVKNHSATKDCWLIINGQVYDVTPFMDDHPGGDEVLLAATGKDATNDFEDVGHSNSAREMMGKYFIGQIDASTIPSKRAYVPP | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,391.575 | ||
| Theoretical pI: | 5.432 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 23.588 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
| Helix | 0.231 | ||
| turn | 0.260 | ||
| sheet | 0.212 | ||