| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145488.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
| ANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVR | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,658.687 | ||
| Theoretical pI: | 10.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.407 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.341 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145488.1 | internal | 137 | 412-2(-) |
Amino Acid sequence : | |||
| PHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGIPEIEGRGGIEHSR TESEWNERHLDCFALIC | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,658.687 | ||
| Theoretical pI: | 10.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.407 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.341 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145488.1 | 5prime_partial | 135 | 414-7(-) |
Amino Acid sequence : | |||
| ALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTR EPNPNGTSDILIALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,658.687 | ||
| Theoretical pI: | 10.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.407 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.341 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145488.1 | internal | 137 | 2-412(+) |
Amino Acid sequence : | |||
| ANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVR | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,658.687 | ||
| Theoretical pI: | 10.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.407 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.341 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145488.1 | internal | 137 | 412-2(-) |
Amino Acid sequence : | |||
| PHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGIPEIEGRGGIEHSR TESEWNERHLDCFALIC | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,658.687 | ||
| Theoretical pI: | 10.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.407 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.341 | ||
| sheet | 0.244 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145488.1 | 5prime_partial | 135 | 414-7(-) |
Amino Acid sequence : | |||
| ALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTR EPNPNGTSDILIALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,658.687 | ||
| Theoretical pI: | 10.850 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 42.407 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.081 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.341 | ||
| sheet | 0.244 | ||