Acc_NO	ORF type	length	start-end position (strand +/-)
>EX145488.1	internal	137	2-412(+)
Amino Acid sequence :
ANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVR
Physicochemical properties
Number of amino acids:		137
Molecular weight:		14,658.687
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		42.407
aromaticity		0.089
GRAVY		0.081
Secondary Structure Fraction
Helix		0.304
turn		0.341
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX145488.1	internal	137	412-2(-)
Amino Acid sequence :
PHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGIPEIEGRGGIEHSR TESEWNERHLDCFALIC
Physicochemical properties
Number of amino acids:		137
Molecular weight:		14,658.687
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		42.407
aromaticity		0.089
GRAVY		0.081
Secondary Structure Fraction
Helix		0.304
turn		0.341
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX145488.1	5prime_partial	135	414-7(-)
Amino Acid sequence :
ALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTR EPNPNGTSDILIALL*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		14,658.687
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		42.407
aromaticity		0.089
GRAVY		0.081
Secondary Structure Fraction
Helix		0.304
turn		0.341
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX145488.1	internal	137	2-412(+)
Amino Acid sequence :
ANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGK FLRRFRMPENAKVEEVR
Physicochemical properties
Number of amino acids:		137
Molecular weight:		14,658.687
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		42.407
aromaticity		0.089
GRAVY		0.081
Secondary Structure Fraction
Helix		0.304
turn		0.341
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX145488.1	internal	137	412-2(-)
Amino Acid sequence :
PHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKVQVVRTGNHVAEEAIDGIPEIEGRGGIEHSR TESEWNERHLDCFALIC
Physicochemical properties
Number of amino acids:		137
Molecular weight:		14,658.687
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		42.407
aromaticity		0.089
GRAVY		0.081
Secondary Structure Fraction
Helix		0.304
turn		0.341
sheet		0.244

Acc_NO	ORF type	length	start-end position (strand +/-)
>EX145488.1	5prime_partial	135	414-7(-)
Amino Acid sequence :
ALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTR EPNPNGTSDILIALL*
Physicochemical properties
Number of amino acids:		135
Molecular weight:		14,658.687
Theoretical pI:		10.850
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		42.407
aromaticity		0.089
GRAVY		0.081
Secondary Structure Fraction
Helix		0.304
turn		0.341
sheet		0.244