| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145492.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
| PRAAGIRHQVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADRNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGL GIDEDEAAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,670.783 | ||
| Theoretical pI: | 11.250 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.231 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145492.1 | internal | 130 | 390-1(-) |
Amino Acid sequence : | |||
| ISSSFILIDAQTQLQHSVDPTSKGIRIVQAEPRSKQSGLIEQQHQILHRLIIPIRLRPLPQLLHDPILRIDLHRLLARHVRAHAAVPQSLRLHDPLHVRSPSVLSRHQAARGIHDPIRDH DLVPNSCSPG | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,670.783 | ||
| Theoretical pI: | 11.250 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.231 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145492.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
| PRAAGIRHQVVVSDRIVDSPCCLVTGEYGWTANMERIMKAQALRDSSMSSYMSSKKTMEINPENGIMEELRKRAEADRNDKSVKDLVLLLYETALLTSGFSLDDPNTFAGRIHRMLKLGL GIDEDEAAAD | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,670.783 | ||
| Theoretical pI: | 11.250 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.231 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145492.1 | internal | 130 | 390-1(-) |
Amino Acid sequence : | |||
| ISSSFILIDAQTQLQHSVDPTSKGIRIVQAEPRSKQSGLIEQQHQILHRLIIPIRLRPLPQLLHDPILRIDLHRLLARHVRAHAAVPQSLRLHDPLHVRSPSVLSRHQAARGIHDPIRDH DLVPNSCSPG | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 14,670.783 | ||
| Theoretical pI: | 11.250 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 66.022 | ||
| aromaticity | 0.008 | ||
| GRAVY | -0.295 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.231 | ||
| sheet | 0.215 | ||