| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145499.1 | internal | 141 | 2-424(+) |
Amino Acid sequence : | |||
| NAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATILRLWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFSSNQFAPNLVAACLNSSQ MIEVMYSYDTNHNLKVLEDYI | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,868.652 | ||
| Theoretical pI: | 4.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 50.340 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.262 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145499.1 | internal | 141 | 2-424(+) |
Amino Acid sequence : | |||
| NAIVSSGLCTVLLHVYFLLGQGITQENANFLMTSPTLLSSPATILRLWDDLGSAEDENQEGYDGSYVEYLMKENPRYSKESARDDVMKMISTSWEALNKECFSSNQFAPNLVAACLNSSQ MIEVMYSYDTNHNLKVLEDYI | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,868.652 | ||
| Theoretical pI: | 4.340 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
| Instability index: | 50.340 | ||
| aromaticity | 0.099 | ||
| GRAVY | -0.206 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.262 | ||
| sheet | 0.305 | ||