| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145501.1 | 5prime_partial | 172 | 529-11(-) |
Amino Acid sequence : | |||
| VRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLAN AEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,066.281 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.325 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.246 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145501.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| EANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSG KFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,066.281 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.325 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.246 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145501.1 | 5prime_partial | 172 | 529-11(-) |
Amino Acid sequence : | |||
| VRIKRSTDQPEMSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLAN AEVSLGKFKLFARGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIALL* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,066.281 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.325 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.246 | ||
| sheet | 0.240 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX145501.1 | 5prime_partial | 167 | 3-506(+) |
Amino Acid sequence : | |||
| EANQSKAIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANNLNFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSG KFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDISG* | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 19,066.281 | ||
| Theoretical pI: | 6.267 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16500 | ||
| Instability index: | 55.325 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.702 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.246 | ||
| sheet | 0.240 | ||